PDB entry 1zfp

View 1zfp on RCSB PDB site
Description: growth factor receptor binding protein sh2 domain complexed with a phosphotyrosyl pentapeptide
Class: complex (signal transduction/peptide)
Keywords: signal transduction, sh2 domain, phosphotyrosyl peptide, complex (signal transduction/peptide)
Deposited on 1998-03-26, released 1999-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: growth factor receptor binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: THE PROTEIN WAS EXPRESSED AS A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zfpe_
  • Chain 'I':
    Compound: epidermal growth factor receptor-derived peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZFP (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zfpE (E:)
    kphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq
    

  • Chain 'I':
    No sequence available.