PDB entry 1zfo

View 1zfo on RCSB PDB site
Description: amino-terminal lim-domain peptide of lasp-1, nmr
Class: metal-binding protein
Keywords: lim domain, zinc-finger, metal-binding protein
Deposited on 1996-05-06, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lasp-1
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80171 (0-29)
  Domains in SCOPe 2.06: d1zfoa_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zfoA (A:)
  mnpncarcgkivyptekvncldkfwhkacf