PDB entry 1zfl

View 1zfl on RCSB PDB site
Description: Solution structure of III-A, the major intermediate in the oxidative folding of leech carboxypeptidase inhibitor
Class: hydrolase inhibitor
Keywords: carboxypeptidase inhibitor, folding intermediate, oxidative folding, four-stranded antiparallel beta-sheet, HYDROLASE INHIBITOR
Deposited on 2005-04-20, released 2005-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Metallocarboxypeptidase inhibitor
  Species: Hirudo medicinalis [TaxId:6421]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81511 (1-66)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1zfla2, d1zfla3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zflA (A:)
  gshtpdesflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrt
  tcipyve