PDB entry 1zfj

View 1zfj on RCSB PDB site
Description: inosine monophosphate dehydrogenase (impdh; ec 1.1.1.205) from streptococcus pyogenes
Deposited on 1999-03-29, released 2000-03-29
The last revision prior to the SCOP 1.67 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.232
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zfjA (A:)
    snwdtkflkkgytfddvllipaeshvlpnevdlktkladnltlnipiitaamdtvtgskm
    aiaiaragglgvihknmsiteqaeevrkvkrsengviidpffltpehkvseaeelmqryr
    isgvpivetlanrklvgiitnrdmrfisdynapisehmtsehlvtaavgtdletaerilh
    ehrieklplvdnsgrlsglitikdiekviefphaakdefgrllvaaavgvtsdtferaea
    lfeagadaividtahghsagvlrkiaeirahfpnrtliagniataegaralydagvdvvk
    vgigpgsicttrvvagvgvpqvtaiydaaavareygktiiadggikysgdivkalaaggn
    avmlgsmfagtdeapgeteiyqgrkyktyrgmgsiaamkkgssdryfqgsvneanklvpe
    giegrvaykgaasdivfqmlggirsgmgyvgagdiqelhenaqfvemsgaglieshphdv
    qitneapnysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zfjA (A:)
    snwdtkflkkgytfddvllipaeshvlpnevdlktkladnltlnipiitaamdtvtgskm
    aiaiaragglgvihknmsiteqaeevrkvkrsengviidpffltpehkvseaeelmqryr
    isgvpivetlanrklvgiitnrdmrfisdynapisehmtsehlvtaavgtdletaerilh
    ehrieklplvdnsgrlsglitikdiekviefphaakdefgrllvaaavgvtsdtferaea
    lfeagadaividtahghsagvlrkiaeirahfpnrtliagniataegaralydagvdvvk
    vgigpgsicttrvvagvgvpqvtaiydaaavareygktiiadggikysgdivkalaaggn
    avmlgsmfagtdeapgeteiyqgrkyktyrgmgsiaamkknklvpegiegrvaykgaasd
    ivfqmlggirsgmgyvgagdiqelhenaqfvemsgaglieshphdvqitneapnysv