PDB entry 1zen

View 1zen on RCSB PDB site
Description: class ii fructose-1,6-bisphosphate aldolase
Deposited on 1996-07-08, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1zen__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1zen_ (-)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zen_ (-)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgalyt
    qpedvdyaytelskisprftiaasfgnvhgvkpgnvvltptilrdsqeyvskkhnlphns
    lnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqgqlgnpk
    gedqpnkkyydprvwlragqtsmiarlekafqelnaid