PDB entry 1zem

View 1zem on RCSB PDB site
Description: Crystal Structure of NAD+-Bound Xylitol Dehydrogenase
Class: Oxidoreductase
Keywords: Rossmann fold, Dinucleotide-binding domain, Oxidoreductase
Deposited on 2005-04-19, released 2006-03-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zema1
  • Chain 'B':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zemb_
  • Chain 'C':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zemc_
  • Chain 'D':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zemd_
  • Chain 'E':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zeme_
  • Chain 'F':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zemf_
  • Chain 'G':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zemg_
  • Chain 'H':
    Compound: xylitol dehydrogenase
    Species: Gluconobacter oxydans [TaxId:442]
    Gene: AB091690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zemh_
  • Heterogens: MG, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zemA (A:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemA (A:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zemB (B:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemB (B:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zemC (C:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemC (C:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zemD (D:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemD (D:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1zemE (E:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemE (E:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1zemF (F:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemF (F:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1zemG (G:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemG (G:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1zemH (H:)
    mskkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvears
    yvcdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtga
    fhvlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapyni
    rvnaispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgv
    vafllgddssfmtgvnlpiagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zemH (H:)
    kkfngkvclvtgaggniglatalrlaeegtaialldmnrealekaeasvrekgvearsyv
    cdvtseeavigtvdsvvrdfgkidflfnnagyqgafapvqdypsddfarvltinvtgafh
    vlkavsrqmitqnygrivntasmagvkgppnmaaygtskgaiialtetaaldlapynirv
    naispgymgpgfmwerqvelqakvgsqyfstdpkvvaqqmigsvpmrrygdineipgvva
    fllgddssfmtgvnlpiagg