PDB entry 1zei

View 1zei on RCSB PDB site
Description: cross-linked b28 asp insulin
Deposited on 1998-07-14, released 1999-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1zeia_
  • Chain 'B':
    Domains in SCOP 1.55: d1zeib_
  • Chain 'C':
    Domains in SCOP 1.55: d1zeic_
  • Chain 'D':
    Domains in SCOP 1.55: d1zeid_
  • Chain 'E':
    Domains in SCOP 1.55: d1zeie_
  • Chain 'F':
    Domains in SCOP 1.55: d1zeif_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zeiA (A:)
    fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zeiB (B:)
    fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zeiC (C:)
    fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zeiD (D:)
    fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zeiE (E:)
    fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zeiF (F:)
    fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn