PDB entry 1zeh

View 1zeh on RCSB PDB site
Description: structure of insulin
Class: hormone
Keywords: hormone, metabolic role, chemical activity, insulin mutant, cross-link, glucose metabolism, diabetes
Deposited on 1998-05-01, released 1998-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.159
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1zeh.1
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered (27)
  Domains in SCOPe 2.07: d1zeh.1
• Chain 'C':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.07: d1zeh.2
• Chain 'D':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered (27)
  Domains in SCOPe 2.07: d1zeh.2
• Heterogens: ZN, CL, CRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zehA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zehB (B:)
  fvnqhlcgshlvealylvcgergffytdkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zehC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zehD (D:)
  fvnqhlcgshlvealylvcgergffytdkt