PDB entry 1zeb

View 1zeb on RCSB PDB site
Description: X-ray structure of alkaline phosphatase from human placenta in complex with 5'-AMP
Class: hydrolase
Keywords: alkaline phosphatase, 5'-amp, phosphoserine
Deposited on 2005-04-18, released 2005-06-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1zeba1
  • Heterogens: NAG, ZN, MG, CA, PO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zebA (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
    gttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zebA (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa