PDB entry 1zeb

View 1zeb on RCSB PDB site
Description: X-ray structure of alkaline phosphatase from human placenta in complex with 5'-AMP
Class: hydrolase
Keywords: alkaline phosphatase, 5'-amp, phosphoserine, hydrolase
Deposited on 2005-04-18, released 2005-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zeba_
  • Heterogens: NAG, ZN, MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zebA (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa
    gttd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zebA (A:)
    iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
    dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
    cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
    egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
    rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
    rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
    vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
    qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa