PDB entry 1ze3

View 1ze3 on RCSB PDB site
Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH
Class: chaperone/structural/membrane protein
Keywords: Usher, soluble domain, ternary complex with chaperone and pilus subunit, CHAPERONE/STRUCTURAL/MEMBRANE PROTEIN COMPLEX
Deposited on 2005-04-17, released 2005-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: fimC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ze3c1, d1ze3c2
  • Chain 'D':
    Compound: Outer membrane usher protein fimD
    Species: Escherichia coli [TaxId:562]
    Gene: fimD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ze3d1
  • Chain 'H':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:562]
    Gene: fimH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ze3h_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ze3C (C:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ze3D (D:)
    dlyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgi
    vpcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafm
    snrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ze3D (D:)
    dlyfnprfllsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgivpcltraql
    asmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafmsnrar
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ze3H (H:)
    tggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfsp
    aqgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfv
    yq