PDB entry 1ze2

View 1ze2 on RCSB PDB site
Description: Conformational change of pseudouridine 55 synthase upon its association with RNA substrate
Class: lyase/RNA
Keywords: Protein-RNA complex, LYASE/RNA COMPLEX
Deposited on 2005-04-16, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.261
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase B
    Species: Thermotoga maritima [TaxId:2336]
    Gene: truB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZW0 (0-End)
      • see remark 999 (295)
      • see remark 999 (306)
    Domains in SCOPe 2.07: d1ze2a1, d1ze2a2
  • Chain 'B':
    Compound: tRNA pseudouridine synthase B
    Species: Thermotoga maritima [TaxId:2336]
    Gene: truB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZW0 (0-End)
      • see remark 999 (306)
    Domains in SCOPe 2.07: d1ze2b1, d1ze2b2
  • Chain 'C':
    Compound: 5'-r(*gp*gp*cp*cp*ap*cp*gp*gp*up*(fhu)p*cp*gp*ap*ap*up*cp*cp*gp*up*gp*gp*c)-3'
  • Chain 'D':
    Compound: 5'-r(*gp*gp*cp*cp*ap*cp*gp*gp*up*(fhu)p*cp*gp*ap*ap*up*cp*cp*gp*up*gp*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ze2A (A:)
    mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
    kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
    kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
    klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclewlprvvvhqestk
    milngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfletlrkherqervl
    tlrkvfqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ze2A (A:)
    mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
    kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
    kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
    klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclewlprvvvhqestk
    milngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfrqervltlrkvfqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ze2B (B:)
    mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
    kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
    kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
    klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclewlprvvvhqestk
    milngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfletlrkherqervl
    tlrkvfqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ze2B (B:)
    mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
    kdlkkvygeydqvppaysakkykgerlyklaregkiinlppkrvkifkirvevspgtyir
    vresvgphtieeslnvfeaapeeienriiplekclewlprvvvhqestkmilngsqihle
    mlkewdgfkkgevvrvfneegrllalaeaernrkvfqt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.