PDB entry 1zdz

View 1zdz on RCSB PDB site
Description: Human spermidine synthase
Class: transferase
Keywords: SGC,spermidine synthase, Structural Genomics, Structural Genomics Consortium
Deposited on 2005-04-15, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2006-12-12, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.203
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spermidine synthase
    Species: HOMO SAPIENS
    Gene: SRM, SPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zdza_
  • Chain 'B':
    Compound: spermidine synthase
    Species: HOMO SAPIENS
    Gene: SRM, SPS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zdzb_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zdzA (A:)
    mepgpdgpaasgpaairegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktyg
    nvlvldgviqcterdefsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesv
    vqceidedviqvskkflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgp
    aeslfkesyyqlmktalkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctipt
    ypsgqigfmlcsknpstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd
    vs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zdzA (A:)
    airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
    defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
    kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
    talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
    pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zdzB (B:)
    mepgpdgpaasgpaairegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktyg
    nvlvldgviqcterdefsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesv
    vqceidedviqvskkflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgp
    aeslfkesyyqlmktalkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctipt
    ypsgqigfmlcsknpstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd
    vs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zdzB (B:)
    airegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcter
    defsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvsk
    kflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlmk
    talkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcskn
    pstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalnd