PDB entry 1zdv

View 1zdv on RCSB PDB site
Description: Solution Structure of the type 1 pilus assembly platform FimD(25-139)
Class: membrane protein
Keywords: beta sheet, alpha helix
Deposited on 2005-04-15, released 2005-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Outer membrane usher protein fimD
  Species: Escherichia coli
  Gene: fimD
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30130 (0-114)
  Domains in SCOP 1.73: d1zdva1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zdvA (A:)
  gqelppgtyrvdiylnngymatrdvtfntgdseqgivpcltraqlasmglntasvagmnl
  laddacvplttmvqdatahldvgqqrlnltipqafmsnrargyippelwdpgina