PDB entry 1zdq

View 1zdq on RCSB PDB site
Description: Crystal Structure of Met150Gly AfNiR with Methylsulfanyl Methane Bound
Class: oxidoreductase
Keywords: Metal-binding, Nitrate assimiliation, OXIDOREDUCTASE
Deposited on 2005-04-14, released 2006-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (Start-335)
      • engineered (146)
    Domains in SCOPe 2.06: d1zdqa1, d1zdqa2
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-335)
      • engineered (146)
    Domains in SCOPe 2.06: d1zdqb1, d1zdqb2
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-335)
      • engineered (146)
    Domains in SCOPe 2.06: d1zdqc1, d1zdqc2
  • Heterogens: CU, MSM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zdqA (A:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zdqA (A:)
    taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
    ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
    katkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvgeqdfy
    vprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvliv
    hsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayv
    nhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zdqB (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zdqC (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg