PDB entry 1zdn

View 1zdn on RCSB PDB site
Description: Ubiquitin-conjugating enzyme E2S
Class: Ligase
Keywords: structural genomics consortium, ubiquitin, ubiquitin-conjugating enzyme, ligase, sgc
Deposited on 2005-04-14, released 2005-05-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2S
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2S, E2EPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zdna1
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2S
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2S, E2EPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zdnb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zdnA (A:)
    gsmnsnvenlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagg
    lfrmklllgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikc
    llihpnpesalneeagrlllenyeeyaararllteihg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zdnA (A:)
    enlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmkll
    lgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnp
    esalneeagrlllenyeeyaararllteihg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zdnB (B:)
    gsmnsnvenlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagg
    lfrmklllgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikc
    llihpnpesalneeagrlllenyeeyaararllteihg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zdnB (B:)
    phiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmklllgkd
    fpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnpesal
    neeagrlllenyeeyaararllteihg