PDB entry 1zdh

View 1zdh on RCSB PDB site
Description: ms2 coat protein/RNA complex
Class: Virus/RNA
Keywords: COMPLEX (COAT PROTEIN-RNA), COAT PROTEIN, RNA-BINDING, VIRAL PROTEIN CAPSID, RNA FRAGMENT, Icosahedral virus, Virus-RNA COMPLEX
Deposited on 1996-09-24, released 1997-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bacteriophage ms2 coat protein)
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zdha_
  • Chain 'B':
    Compound: protein (bacteriophage ms2 coat protein)
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zdhb_
  • Chain 'C':
    Compound: protein (bacteriophage ms2 coat protein)
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zdhc_
  • Chain 'R':
    Compound: RNA (5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up*cp*ap*cp*cp*cp*ap*u p*gp*u)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'S':
    Compound: RNA (5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up*cp*ap*cp*cp*cp*ap*u p*gp*u)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zdhA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zdhB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zdhC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.