PDB entry 1zd0

View 1zd0 on RCSB PDB site
Description: Crystal structure of Pfu-542154 conserved hypothetical protein
Class: structural genomics, unknown function
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2005-04-13, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PF0523
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF0523
    Database cross-references and differences (RAF-indexed):
    • GB NP_578252 (9-End)
      • expression tag (4-6)
      • cloning artifact (7-8)
    Domains in SCOPe 2.07: d1zd0a1, d1zd0a2
  • Heterogens: MG, UNX, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zd0A (A:)
    ahhhhhhgsleirtkvgeiciskvwltdeqinklfdrfkgdyqvvnaecadkvifatiia
    ikavkegrsiaktvpgeilvrlsgnrqikeaikkvgakegenyivtfgenasallqkils
    tleikelelercdleyakkafediaiieal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zd0A (A:)
    hhhgsleirtkvgeiciskvwltdeqinklfdrfkgdyqvvnaecadkvifatiiaikav
    kegrsiaktvpgeilvrlsgnrqikeaikkvgakegenyivtfgenasallqkilstlei
    kelelercdleyakkafedia