PDB entry 1zcy

View 1zcy on RCSB PDB site
Description: apo form of a mutant of glycogenin in which Asp159 is replaced by Ser
Class: transferase
Keywords: glycosyltransferase, TRANSFERASE
Deposited on 2005-04-13, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogenin-1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: GYG, GYG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13280 (20-End)
      • engineered (179)
    Domains in SCOPe 2.08: d1zcya1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zcyA (A:)
    mgsshhhhhhssglvprgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavltt
    pqvsdtmrkaleivfdevitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvf
    mdadtlvlaniddlfereelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfs
    ggdqgllntffnswattdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpw
    nytydtktksvrseghdptmthpqflnvwwdifttsvvpllqqfglvqdtcsyqhvedvs
    gavshlslgetpattqpfvsseerkerweqgqadymgadsfdnikkkldtylq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcyA (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfsggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrspqflnvw
    wdifttsvvpllqqfgl