PDB entry 1zcx

View 1zcx on RCSB PDB site
Description: Cyclophilin_ABH_like domain of peptidylprolyl isomerase E isoform 1 [Homo sapiens]
Class: Isomerase
Keywords: cis-trans isomerization, structural genomics consortium, sgc
Deposited on 2005-04-13, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-09-25, with a file datestamp of 2007-09-21.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.164
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase e
    Species: HOMO SAPIENS
    Gene: PPIE, CYP33
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zcxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zcxA (A:)
    glvprgspiakkarsnpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfg
    fkgssfhriipqfmcqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpnt
    ngsqffltcdktdwldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcxA (A:)
    snpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfm
    cqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdw
    ldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv