PDB entry 1zct

View 1zct on RCSB PDB site
Description: structure of glycogenin truncated at residue 270 in a complex with UDP
Class: transferase
Keywords: glycosyltransferase, TRANSFERASE
Deposited on 2005-04-13, released 2005-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogenin-1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: GYG, GYG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zcta_
  • Chain 'B':
    Compound: glycogenin-1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: GYG, GYG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zctb_
  • Heterogens: MN, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zctA (A:)
    mgsshhhhhhssglvprgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavltt
    pqvsdtmrkaleivfdevitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvf
    mdadtlvlaniddlfereelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfd
    ggdqgllntffnswattdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpw
    nytydtktksvrseghdptmthpqflnvwwdifttsvvpllqqfglvqdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zctA (A:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdppq
    flnvwwdifttsvvpllq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zctB (B:)
    mgsshhhhhhssglvprgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavltt
    pqvsdtmrkaleivfdevitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvf
    mdadtlvlaniddlfereelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfd
    ggdqgllntffnswattdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpw
    nytydtktksvrseghdptmthpqflnvwwdifttsvvpllqqfglvqdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zctB (B:)
    mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
    vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
    saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
    khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdppq
    flnvwwdifttsvvpllq