PDB entry 1zcn

View 1zcn on RCSB PDB site
Description: human Pin1 Ng mutant
Class: isomerase
Keywords: WW domain, type I beta-turn, ISOMERASE
Deposited on 2005-04-12, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-158)
      • engineered (16)
    Domains in SCOPe 2.07: d1zcna1, d1zcna2
  • Heterogens: PO4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zcnA (A:)
    madeeklppgwekrmsngrvyyfnhitnasqwerpsgnsssggkngqgeparvrcshllv
    khsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakargdl
    gafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcnA (A:)
    lppgwekrmsngrvyyfnhitnasqwerpseparvrcshllvkhsqsrrpsswrqekitr
    tkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmqkpfedasfa
    lrtgemsgpvftdsgihiilrte