PDB entry 1zck

View 1zck on RCSB PDB site
Description: native structure prl-1 (ptp4a1)
Class: hydrolase
Keywords: prl-1 ptp4a1, HYDROLASE
Deposited on 2005-04-12, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.245
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein tyrosine phosphatase 4a1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q78EG7 (Start-153)
      • modified residue (10)
      • modified residue (117)
      • modified residue (149)
      • insertion (149)
    Domains in SCOPe 2.07: d1zcka_
  • Chain 'B':
    Compound: protein tyrosine phosphatase 4a1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q78EG7 (Start-153)
      • modified residue (10)
      • modified residue (117)
      • modified residue (149)
      • insertion (149)
    Domains in SCOPe 2.07: d1zckb_
  • Chain 'C':
    Compound: protein tyrosine phosphatase 4a1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q78EG7 (Start-153)
      • modified residue (10)
      • modified residue (117)
      • modified residue (149)
      • insertion (149)
    Domains in SCOPe 2.07: d1zckc_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zckA (A:)
    papvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvl
    dwpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmky
    edavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zckA (A:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyedav
    qfirqkrrgafnskqllylekyrpkmrlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zckB (B:)
    papvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvl
    dwpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmky
    edavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zckB (B:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
    avqfirqkrrgafnskqllylekyrpkmrlrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zckC (C:)
    papvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvl
    dwpfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmky
    edavqfirqkrrgafnskqllylekyrpkmrlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zckC (C:)
    pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
    pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
    avqfirqkrrgafnskqllylekyrpkmrlrf