PDB entry 1zch

View 1zch on RCSB PDB site
Description: Structure of the hypothetical oxidoreductase YcnD from Bacillus subtilis
Class: oxidoreductase
Keywords: nitroreductase, NADH-oxidase, Oxidoreductase
Deposited on 2005-04-12, released 2005-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical oxidoreductase ycnD
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ycnD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zcha1
  • Heterogens: CL, CA, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zchA (A:)
    mneviksltdhrsirsytdepvaqeqldqiieavqsapssingqqvtvitvqdkerkkki
    selaggqpwidqapvfllfcadfnrakialedlhdfkmeitnglesvlvgavdagialgt
    ataaaeslglgtvpigavrgnpqeliellelpkyvfplsglvighpadrsakkprlpqea
    vnhqetylnqdeltshiqaydeqmseymnkrtngketrnwsqsiasyyerlyyphireml
    ekqgfkvekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zchA (A:)
    mneviksltdhrsirsytdepvaqeqldqiieavqsapssingqqvtvitvqdkerkkki
    selaggqpwidqapvfllfcadfnrakialedlhdfkmeitnglesvlvgavdagialgt
    ataaaeslglgtvpigavrgnpqeliellelpkyvfplsglvighpadrsakkprlpqea
    vnhqetylnqdeltshiqaydeqmseymnkrtngketrnwsqsiasyyerlyyphireml
    ekqgfkvek