PDB entry 1zce

View 1zce on RCSB PDB site
Description: X-Ray Crystal Structure of Protein Atu2648 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR33.
Class: structural genomics, unknown function
Keywords: alpha-beta protein., Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-04-11, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-06-09, with a file datestamp of 2010-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.195
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein Atu2648
  Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
  Gene: locus_tag="Atu2648"
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8UC50 (Start-146)
    • modified residue (17)
    • modified residue (40)
    • modified residue (43)
    • modified residue (93)
    • modified residue (111)
    • modified residue (117)
    • modified residue (135)
  Domains in SCOPe 2.08: d1zcea1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1zceA (A:)
  manywlyksepfkwswemqkakgetgeewtgvrnyqarnnmramkigdkgffyhsnegld
  vvgivevcalshpdstaegdlkwdcvdiravcdmpqpvslkdvkanpklekmslvtsmrl
  svqpvteeeylevcrmgglanppkspdlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1zceA (A:)
  anywlyksepfkwswemqkakgetgeewtgvrnyqarnnmramkigdkgffyhsnegldv
  vgivevcalshpdstaegdlkwdcvdiravcdmpqpvslkdvkanpklekmslvtsmrls
  vqpvteeeylevcrmgglanppkspd