PDB entry 1zcb

View 1zcb on RCSB PDB site
Description: Crystal structure of G alpha 13 in complex with GDP
Class: signaling protein
Keywords: GTP-binding, Lipoprotein, Membrane, Transducer
Deposited on 2005-04-11, released 2005-11-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G alpha i/13
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27601
      • cloning artifact (30)
    • Uniprot P27601 (31-End)
    Domains in SCOP 1.73: d1zcba1, d1zcba2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zcbA (A:)
    mgctlsaedkaaverskmidrnlredgersarlvkilllgagesgkstflkqmriihgqd
    fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
    mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
    illarrptkgiheydfeiknvpfkmvdvggqrserkrwfecfdsvtsilflvsssefdqv
    lmedrqtnrlteslnifetivnnrvfsnvsiilflnktdlleekvqvvsikdyflefegd
    phclrdvqkflvecfrgkrrdqqqrplyhhfttaintenirlvfrdvkdtilhdnlkqlm
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zcbA (A:)
    arlvkilllgagesgkstflkqmriihgqdfdqrareefrptiysnvikgmrvlvdarek
    lhipwgdnknqlhgdklmafdtrapmaaqgmvetrvflqylpairalwedsgiqnaydrr
    refqlgesvkyfldnldklgvpdyipsqqdillarrptkgiheydfeiknvpfkmvdvgg
    wfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilflnk
    tdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdqqplyhhfttainten
    irlvfrdvkdtilhdnlk