PDB entry 1zc8

View 1zc8 on RCSB PDB site
Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex
Class: RNA binding protein/RNA
Keywords: SmpB, tmRNA, EF-Tu, h44, 30S, 16s rRNA, Cryo-EM, trans-translation, 70S
Deposited on 2005-04-11, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-19, with a file datestamp of 2007-06-28.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TLD 16S ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'B':
    Compound: H2 16S rRNA
    Species: Thermus thermophilus
  • Chain 'C':
    Compound: H2b d mRNA
    Species: Thermus thermophilus
  • Chain 'F':
    Compound: H5 16S ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'G':
    Compound: protein kinase 4 mRNA
    Species: Thermus thermophilus
  • Chain 'H':
    Compound: protein kinase 2 mRNA
    Species: Thermus thermophilus
  • Chain 'I':
    Compound: protein kinase 3
    Species: Thermus thermophilus
  • Chain 'J':
    Compound: protein kinase 4 mRNA
    Species: Thermus thermophilus
  • Chain 'K':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus
    Domains in SCOP 1.73: d1zc8k1
  • Chain 'Y':
    Compound: elongation factor tu
    Species: Thermus thermophilus
    Domains in SCOP 1.73: d1zc8y1, d1zc8y2, d1zc8y3
  • Chain 'Z':
    Compound: H44 16S ribosomal RNA
    Species: Thermus thermophilus

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zc8K (K:)
    gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
    lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
    lialakgkkl
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zc8Y (Y:)
    akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
    itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
    llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
    emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
    riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
    gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
    mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

  • Chain 'Z':
    No sequence available.