PDB entry 1zc8
View 1zc8 on RCSB PDB site
Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex
Class: RNA binding protein/RNA
Keywords: SmpB, tmRNA, EF-Tu, h44, 30S, 16s rRNA, Cryo-EM, trans-translation, 70S
Deposited on
2005-04-11, released
2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated
2005-04-19, with a file datestamp of
2007-06-28.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: TLD 16S ribosomal RNA
Species: Thermus thermophilus
- Chain 'B':
Compound: H2 16S rRNA
Species: Thermus thermophilus
- Chain 'C':
Compound: H2b d mRNA
Species: Thermus thermophilus
- Chain 'F':
Compound: H5 16S ribosomal RNA
Species: Thermus thermophilus
- Chain 'G':
Compound: protein kinase 4 mRNA
Species: Thermus thermophilus
- Chain 'H':
Compound: protein kinase 2 mRNA
Species: Thermus thermophilus
- Chain 'I':
Compound: protein kinase 3
Species: Thermus thermophilus
- Chain 'J':
Compound: protein kinase 4 mRNA
Species: Thermus thermophilus
- Chain 'K':
Compound: SsrA-binding protein
Species: Thermus thermophilus
Domains in SCOP 1.73: d1zc8k1 - Chain 'Y':
Compound: elongation factor tu
Species: Thermus thermophilus
Domains in SCOP 1.73: d1zc8y1, d1zc8y2, d1zc8y3 - Chain 'Z':
Compound: H44 16S ribosomal RNA
Species: Thermus thermophilus
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
Sequence; same for both SEQRES and ATOM records: (download)
>1zc8K (K:)
gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
lialakgkkl
- Chain 'Y':
Sequence; same for both SEQRES and ATOM records: (download)
>1zc8Y (Y:)
akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatg
riergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvglllrgvsreever
gqvlakpgsitphtkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgve
mvmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
- Chain 'Z':
No sequence available.