PDB entry 1zc6

View 1zc6 on RCSB PDB site
Description: Crystal Structure of Putative N-acetylglucosamine Kinase from Chromobacterium violaceum. Northeast Structural Genomics Target Cvr23.
Class: structural genomics, unknown function
Keywords: N-acetylglucosamine kinase, NESG, Q7NU07_CHRVO, cvr23, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-04-11, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.241
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable N-acetylglucosamine kinase
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV2896
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NU07
      • modified residue (36)
      • modified residue (172)
      • modified residue (198)
    Domains in SCOPe 2.07: d1zc6a1, d1zc6a2
  • Chain 'B':
    Compound: probable N-acetylglucosamine kinase
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV2896
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7NU07
      • modified residue (5)
      • modified residue (36)
      • modified residue (172)
      • modified residue (198)
    Domains in SCOPe 2.07: d1zc6b1, d1zc6b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zc6A (A:)
    marqtmnpsiryligvdgggtgtrirlhasdgtplamaeggasalsqgiakswqavlstl
    eaafqqaglpaapasacaiglglsgvhnrqwagefesqapgfarlslatdgyttllgahg
    gqpgiivalgtgsigealypdgshreaggwgypsgdeasgawlgqraaqltqmaldgrhs
    hspltravldfvggdwqammawngratpaqfarlaplvlsaarvdpeadallrqagedaw
    aiaraldpqdelpvalcgglgqalrdwlppgfrqrlvapqgdsaqgallllqrpstrleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc6A (A:)
    psiryligvdgggtgtrirlhasdgtplamaeggasalsqgiakswqavlstleaafqqa
    glpaapasacaiglglsgvhnrqwagefesqapgfarlslatdgyttllgahggqpgiiv
    algtgsigealypdgshreaggwgypsgdeasgawlgqraaqltqmaldgrhshspltra
    vldfvggdwqammawngratpaqfarlaplvlsaarvdpeadallrqagedawaiarald
    pqdelpvalcgglgqalrdwlppgfrqrlvapqgdsaqgallllq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zc6B (B:)
    marqtmnpsiryligvdgggtgtrirlhasdgtplamaeggasalsqgiakswqavlstl
    eaafqqaglpaapasacaiglglsgvhnrqwagefesqapgfarlslatdgyttllgahg
    gqpgiivalgtgsigealypdgshreaggwgypsgdeasgawlgqraaqltqmaldgrhs
    hspltravldfvggdwqammawngratpaqfarlaplvlsaarvdpeadallrqagedaw
    aiaraldpqdelpvalcgglgqalrdwlppgfrqrlvapqgdsaqgallllqrpstrleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc6B (B:)
    rqtmnpsiryligvdgggtgtrirlhasdgtplamaeggasalsqgiakswqavlstlea
    afqqaglpaapasacaiglglsgvhnrqwagefesqapgfarlslatdgyttllgahggq
    pgiivalgtgsigealypdgshreaggwgypsgdeasgawlgqraaqltqmaldgrhshs
    pltravldfvggdwqammawngratpaqfarlaplvlsaarvdpeadallrqagedawai
    araldpqdelpvalcgglgqalrdwlppgfrqrlvapqgdsaqgallllqrps