PDB entry 1zc4

View 1zc4 on RCSB PDB site
Description: Crystal structure of the Ral-binding domain of Exo84 in complex with the active RalA
Class: signaling protein
Keywords: exocytosis, small GTPase, GTP-binding protein,
Deposited on 2005-04-10, released 2005-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: HOMO SAPIENS
    Gene: RALA, RAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11233 (Start-174)
      • engineered (63)
    Domains in SCOP 1.73: d1zc4a1
  • Chain 'B':
    Compound: exocyst complex protein Exo84
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zc4b1
  • Chain 'C':
    Compound: Ras-related protein Ral-A
    Species: HOMO SAPIENS
    Gene: RALA, RAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11233 (Start-174)
      • engineered (63)
    Domains in SCOP 1.73: d1zc4c1
  • Chain 'D':
    Compound: exocyst complex protein Exo84
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1zc4d1
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zc4A (A:)
    qnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidild
    tagledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnk
    sdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc4A (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zc4B (B:)
    letpgqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldr
    lavvnvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreqeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc4B (B:)
    gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
    nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1zc4C (C:)
    qnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidild
    tagledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnk
    sdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc4C (C:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1zc4D (D:)
    letpgqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldr
    lavvnvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreqeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zc4D (D:)
    gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
    nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkrrreq