PDB entry 1zbz

View 1zbz on RCSB PDB site
Description: High-Resolution Crystal Structure of Compound I intermediate of Cytochrome c Peroxidase (CcP)
Class: oxidoreductase
Keywords: CcP, Heme peroxidase, Trp191 cation radical, Oxyferryl Heme (Fe4+), High-spin heme, OXIDOREDUCTASE
Deposited on 2005-04-09, released 2005-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.116
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zbza_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zbzA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbzA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl