PDB entry 1zbx

View 1zbx on RCSB PDB site
Description: Crystal structure of a Orc1p-Sir1p complex
Class: transcription
Keywords: protein-protein interaction, epigenetics, silencing, silent information regulators, TRANSCRIPTION
Deposited on 2005-04-09, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Origin recognition complex subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Orc1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zbxa1
  • Chain 'B':
    Compound: Regulatory protein SIR1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21691 (Start-134)
      • cloning artifact (133-134)
      • expression tag (135)
    Domains in SCOPe 2.08: d1zbxb1, d1zbxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zbxA (A:)
    maktlkdlqgweiittdeqgniidggqkrlrrrgnktehylkrssdgiklgrgdsvvmhn
    eaagtysvymiqelrlntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyyn
    klfsetanknelyltaelaelqlfnfirvanvmdgskwevlkgnvdperdftvryicept
    gekfvdiniedvkayikkvepreaqeylkdltlpskkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbxA (A:)
    aktlkdlqgweiittdeqgntehylkrssdgiklgrgdsvvmhneaagtysvymiqelrl
    ntlnnvvelwaltylrwfevnplahyrqfnpdanilnrplnyynklfsetanknelylta
    elaelqlfnfirvanvmdgskwevlkgnvdperdftvryiceptgekfvdiniedvkayi
    kkvepreaqeylkdltl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zbxB (B:)
    ekkfsteeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwnd
    fkkyqdpiplkaktlfkfckqikkkflrgadfklhtlpteanlkyepermtvlcscvpil
    lddqtvqylyddslehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbxB (B:)
    teeeyvsprflvadgflidlaeekpinpkdprlltllkdhqramidqmnlvkwndfkkyq
    dpiplkaktlfkfckqikkkflrgadfklhtlpmtvlcscvpillddqtvqylyddsleh