PDB entry 1zbt

View 1zbt on RCSB PDB site
Description: Crystal structure of Peptide chain release factor 1 (RF-1) (SMU.1085) from Streptococcus mutans at 2.34 A resolution
Class: translation
Keywords: SMU.1085, Peptide chain release factor 1 (RF-1), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, TRANSLATION
Deposited on 2005-04-08, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide chain release factor 1
    Species: Streptococcus mutans [TaxId:1309]
    Gene: prfA, rf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DU64 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (77)
      • modified residue (90)
      • modified residue (147)
      • modified residue (162)
      • modified residue (178)
      • modified residue (219)
      • modified residue (269)
      • modified residue (283)
    Domains in SCOPe 2.07: d1zbta1, d1zbta2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zbtA (A:)
    mgsdkihhhhhhmniydqlqavedryeelgellsdpdvvsdtkrfmelsreeansretva
    vyreykqvvqniadaqemikdasgdpeleemakeelknskvakeeyeeklrflllpkdpn
    ddkniileirgaaggdeaalfagdllnmyqkyaenqgwkfevmeasangvgglkevvamv
    sgqsvysklkyesgahrvqrvpvtesqgrvhtstatvlvmpeveeveyeidpkdlrvdiy
    hasgaggqnvnkvatavriihlptnikvemqeertqqknrdkamkiirarvadhfaqiaq
    deqdaerkstvgtgdrserirtynfpqnrvtdhrigltlqkldsilsgkldevidalily
    dqtqkleelnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbtA (A:)
    hhmniydqlqavedryeelreeansretvavyreykqvvqniadaqempeleemakeelk
    nskvakeeyeeklrflllpkdpnddkniileirgaaggdeaalfagdllnmyqkyaenqg
    wkfevmeasangvgglkevvamvsgqsvysklkyesgahrvqrvpvtesqgrvhtstatv
    lvmpeveeveyeidpkdlrvdiyhakvatavriihlptnikvemqeertqqknrdkamki
    irarvadhfaqiaqdeqdatvgtgdrserirtynfpqnrvtdhrigltlqkldsilsgkl
    devidalilydqtqkleeln