PDB entry 1zbs

View 1zbs on RCSB PDB site
Description: Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18
Class: structural genomics, unknown function
Keywords: alpha-beta protein., Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-04-08, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PG1100
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: locus_tag="PG1100"
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MVG4 (0-282)
      • modified residue (0)
      • modified residue (76)
      • modified residue (84)
      • modified residue (97)
      • modified residue (162)
      • modified residue (270)
    Domains in SCOPe 2.08: d1zbsa1, d1zbsa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zbsA (A:)
    miligdsgstktdwciakegkslgrfqtsginpfqqdrneidtalrsevlpaigqkassi
    ravyfygagctpakapmlnealdsmlphcdrievagdmlgaaralcgdsegiacilgtgs
    nsclfdgreikanvsplgyilgdegsgavlgrlfigsllkgqmpeglceaflqeygltsa
    diiesvyrkpfpnrflagfspfiaqhldipavyslvqnsfddflvrnvlrynrpdlplhf
    igsvafhyrevlssvikkrgltlgsvlqspmegliqyhhnnhvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbsA (A:)
    miligdsgstktdwciakegkslgrfqtsginpfqqdrneidtalrsevlpaigqkassi
    ravyfygagctpakapmlnealdsmlphcdrievagdmlgaaralcgdsegiacilgtgs
    nsclfdgreikanvsplgyilgdegsgavlgrlfigsllkgqmpeglceaflqeygltsa
    diiesvyrkpfpnrflagfspfiaqhldipavyslvqnsfddflvrnvlrynrpdlplhf
    igsvafhyrevlssvikkrgltlgsvlqspmegliqyhhnnhv