PDB entry 1zbo

View 1zbo on RCSB PDB site
Description: X-Ray Crystal Structure of Protein BPP1347 from Bordetella parapertussis. Northeast Structural Genomics Consortium Target BoR27.
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-04-08, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BPP1347
    Species: Bordetella parapertussis [TaxId:257311]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WAM7
      • modified residue (30)
      • modified residue (67)
      • modified residue (77)
      • modified residue (147)
      • modified residue (149)
      • modified residue (168)
    Domains in SCOPe 2.08: d1zboa1
  • Chain 'B':
    Compound: hypothetical protein BPP1347
    Species: Bordetella parapertussis [TaxId:257311]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WAM7
      • modified residue (30)
      • modified residue (67)
      • modified residue (77)
      • modified residue (147)
      • modified residue (149)
      • modified residue (168)
    Domains in SCOPe 2.08: d1zbob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zboA (A:)
    maeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgre
    vlaragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplev
    ppelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarl
    lllppldrlreidavlaadghalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zboA (A:)
    aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev
    laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp
    pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll
    llppldrlreidavlaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zboB (B:)
    maeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgre
    vlaragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplev
    ppelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarl
    lllppldrlreidavlaadghalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zboB (B:)
    aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev
    laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp
    pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll
    llppldrlreidavlaadgh