PDB entry 1zbi

View 1zbi on RCSB PDB site
Description: Bacillus halodurans RNase H catalytic domain mutant D132N in complex with 12-mer RNA/DNA hybrid
Class: hydrolase/RNA/DNA
Keywords: RNase H, RNA/DNA hybrid, DDE motif, HYDROLASE-RNA-DNA COMPLEX
Deposited on 2005-04-08, released 2005-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.206
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease H-related protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9 (Start-141)
      • engineered (77)
    Domains in SCOPe 2.06: d1zbia_
  • Chain 'B':
    Compound: ribonuclease H-related protein
    Species: BACILLUS HALODURANS [TaxId:272558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9 (4-End)
      • engineered (77)
    Domains in SCOPe 2.06: d1zbib_
  • Chain 'C':
    Compound: 5'-r(*gp*ap*cp*ap*cp*cp*up*gp*ap*up*up*c)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*ap*ap*tp*cp*ap*gp*gp*tp*gp*tp*c)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zbiA (A:)
    gshmakeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaiv
    hglrylkernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthty
    etpilkwqtdkwgeikadygrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbiA (A:)
    eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
    ernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
    qtdkwgeikadygrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zbiB (B:)
    gshmakeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaiv
    hglrylkernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthty
    etpilkwqtdkwgeikadygrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbiB (B:)
    akeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglr
    ylkernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpi
    lkwqtdkwgeikadyg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.