PDB entry 1zbg
View 1zbg on RCSB PDB site
Description: Crystal structure of a complex of mutant hiv-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[R-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
Class: hydrolase/hydrolase inhibitor
Keywords: hiv, protease, peptidomimetic inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on
2005-04-08, released
2006-04-18
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367
- engineered (70)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.04: d1zbga_ - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (70)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.04: d1zbgb_ - Heterogens: CL, 0ZS, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1zbgA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1zbgB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf