PDB entry 1zbb

View 1zbb on RCSB PDB site
Description: Structure of the 4_601_167 Tetranucleosome
Class: structural protein/DNA
Keywords: tetranucleosome, nucleosome, chromatin, chromatin fiber, histone, protein-DNA interaction, nucleoprotein, supercoiled DNA, nucleosome core, protein-DNA complex, structural protein/DNA complex
Deposited on 2005-04-08, released 2005-07-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 9 Å
R-factor: 0.386
AEROSPACI score: -0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
    Domains in SCOPe 2.03: d1zbba1
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zbbb1
  • Chain 'C':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897 (Start-128)
      • conflict (98)
  • Chain 'D':
    Compound: Histone H2B.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • conflict (31)
    Domains in SCOPe 2.03: d1zbbd1
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
    Domains in SCOPe 2.03: d1zbbe1
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1zbbf1
  • Chain 'G':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897
      • conflict (98)
  • Chain 'H':
    Compound: Histone H2B.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • conflict (31)
  • Chain 'I':
    Compound: DNA strand 1 (arbitrary model sequence)
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: DNA strand 2 (arbitrary model sequence)
    Species: synthetic, synthetic
  • Chain 'a':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
  • Chain 'b':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897 (Start-128)
      • conflict (98)
  • Chain 'd':
    Compound: Histone H2B.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • conflict (31)
  • Chain 'e':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233 (Start-134)
      • conflict (101)
  • Chain 'f':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: histone h2a.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897
      • conflict (98)
  • Chain 'h':
    Compound: Histone H2B.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (Start-124)
      • conflict (31)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1zbbA (A:)
artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirgera

    Sequence, based on observed residues (ATOM records): (download) 
    >1zbbA (A:)
hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
ylvalfedtnlcaihakrvtimpkdiqlarrirgera

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1zbbB (B:)
sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg

    Sequence, based on observed residues (ATOM records): (download) 
    >1zbbB (B:)
vdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt
amdvvyalkrqgrtlygfgg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >1zbbD (D:)
pepaksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskams
imnsfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
ytsak

    Sequence, based on observed residues (ATOM records): (download) 
    >1zbbD (D:)
kkgskkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageas
rlahynkrstitsreiqtavrlllpgelakhavsegtkavtkytsak

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >1zbbE (E:)
artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirgera

    Sequence, based on observed residues (ATOM records): (download) 
    >1zbbE (E:)
hryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeasea
ylvalfedtnlcaihakrvtimpkdiqlarrirgera

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >1zbbF (F:)
sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg

    Sequence, based on observed residues (ATOM records): (download) 
    >1zbbF (F:)
sgrgkgkkrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvird
avtytehakrktvtamdvvyalkrqgrtlygfgg

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.