PDB entry 1zb5

View 1zb5 on RCSB PDB site
Description: Recognition of peptide ligands by signalling protein from porcine mammary gland (SPP-40): Crystal structure of the complex of SPP-40 with a peptide Trp-Pro-Trp at 2.45A resolution
Class: signaling protein
Keywords: peptidic ligands, signaling protein, spp-40
Deposited on 2005-04-07, released 2005-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal processing protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • GB AAV30548 (0-359)
    Domains in SCOPe 2.06: d1zb5a1, d1zb5a2
  • Chain 'B':
    Compound: peptide trp-pro-trp
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZB5 (0-2)
  • Chain 'C':
    Compound: peptide trp-pro-trp
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZB5 (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zb5A (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptfg
    ksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar
    a
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.