PDB entry 1zay

View 1zay on RCSB PDB site
Description: purine repressor-hypoxanthine-modified-purf-operator complex
Class: transcription/DNA
Keywords: complex (DNA-binding regulation-modified DNA), transcription-DNA complex
Deposited on 1998-12-16, released 1999-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (purine repressor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zaya1, d1zaya2
  • Chain 'M':
    Compound: DNA (5'-d(*ap*ap*cp*gp*ap*ap*ap*ap*tp*(1ap)p*tp*tp*tp*tp*cp*gp*t)-3')
  • Heterogens: HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zayA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zayA (A:)
    tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtksi
    gllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvm
    cseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghreig
    vipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpta
    vfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetaf
    nmlldrivnkreepqsievhprlierrsvadgpfrdyr
    

  • Chain 'M':
    No sequence available.