PDB entry 1zat

View 1zat on RCSB PDB site
Description: Crystal Structure of an Enterococcus faecium peptidoglycan binding protein at 2.4 A resolution
Class: transferase
Keywords: L,D-transpeptidation, peptidoglycan, beta-lactam insensitive transpeptidase, antibiotic resistance, TRANSFERASE
Deposited on 2005-04-07, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L,D-transpeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: ldtfm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zata1, d1zata2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zatA (A:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    nddgtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgm
    vekgtpvlvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zatA (A:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    ngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgcintppsvmkelfgmve
    kgtpvlvf