PDB entry 1zar

View 1zar on RCSB PDB site
Description: Crystal Structure of A.fulgidus Rio2 Kinase Complexed With ADP and Manganese Ions
Class: transferase
Keywords: serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, TRANSFERASE
Deposited on 2005-04-06, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rio2 kinase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RIO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zara1, d1zara2
  • Heterogens: MN, ADP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zarA (A:)
    mniaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvv
    qnrqkdyegstftfiglslyslhrlvrsgkvdaigklmgegkesavfncysekfgecvvk
    fhkvghtsfkkvkekrdygdlhfsvlairsarnefralqklqglavpkvyawegnavlme
    lidakelyrvrvenpdevldmileevakfyhrgivhgdlsqynvlvseegiwiidfpqsv
    evgeegwreilerdvrniityfsrtyrtekdinsaidrilqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zarA (A:)
    niaelygkmgkhswrimdaifknlwdyeyvplqlissharigeekarnilkylsdlrvvq
    nrqkdyegstftfiglslyslhrlvrsgkvdaigklmgegkesavfncysekfgecvvkf
    hkvkvkehfsvlairsarnefralqklqglavpkvyawegnavlmelidakelyrvrven
    pdevldmileevakfyhrgivhgdlsqynvlvseegiwiidfpqsvevgeegwreilerd
    vrniityfsrtyrtekdinsaidrilq