PDB entry 1zaq

View 1zaq on RCSB PDB site
Description: fourth egf-like domain of thrombomodulin, nmr, 12 structures
Class: blood coagulation
Keywords: anticoagulant, fibrinogen, nmr, peptide synthesis, protein c, thrombin, blood coagulation
Deposited on 1995-09-09, released 1996-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1zaqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zaqA (A:)
    epvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqmf