PDB entry 1zaq

View 1zaq on RCSB PDB site
Description: fourth egf-like domain of thrombomodulin, nmr, 12 structures
Class: blood coagulation
Keywords: anticoagulant, fibrinogen, nmr, peptide synthesis, protein c, thrombin, blood coagulation
Deposited on 1995-09-09, released 1996-01-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thrombomodulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07204 (0-43)
  Domains in SCOPe 2.05: d1zaqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zaqA (A:)
  epvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqmf