PDB entry 1zap

View 1zap on RCSB PDB site
Description: secreted aspartic protease from c. albicans
Class: aspartic protease
Keywords: aspartic protease, secreted, candida albicans
Deposited on 1996-01-16, released 1997-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.145
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: secreted aspartic proteinase
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28871 (0-341)
      • conflict (44)
      • conflict (80)
      • conflict (163)
      • conflict (277)
      • conflict (282)
      • conflict (301)
      • conflict (326)
      • conflict (337)
    Domains in SCOPe 2.06: d1zapa_
  • Heterogens: ZN, A70, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zapA (A:)
    qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnidcqvtysdqtadfck
    qkgtydpsgssasqdlntpfsigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
    qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdsatgqiifggvdnakys
    gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
    kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasdfaastqgddgqpydkcqllfdv
    nkanilgdnflrsayivydlddneisiaqvkytsasstsalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zapA (A:)
    qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnidcqvtysdqtadfck
    qkgtydpsgssasqdlntpfsigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
    qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdsatgqiifggvdnakys
    gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
    kltqdsngnsyevdcnlsgdvvfnfsknakisvpasdfaastqgddgqpydkcqllfdvn
    kanilgdnflrsayivydlddneisiaqvkytsasstsalt