PDB entry 1zak

View 1zak on RCSB PDB site
Description: adenylate kinase from maize in complex with the inhibitor p1,p5-bis(adenosine-5'-)pentaphosphate (ap5a)
Deposited on 1997-05-31, released 1998-04-08
The last revision prior to the SCOP 1.61 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.218
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zakA (A:)
    adplkvmisgapasgkgtqceliktkyqlahisagdllraeiaagsengkrakefmekgq
    lvpdeivvnmvkerlrqpdaqengwlldgyprsysqamaletleirpdtfilldvpdell
    vervvgrrldpvtgkiyhlkysppeneeiasrltqrfddteekvklrletyyqnieslls
    tyeniivkvqgdatvdavfakidellgsilekknemvsst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zakB (B:)
    adplkvmisgapasgkgtqceliktkyqlahisagdllraeiaagsengkrakefmekgq
    lvpdeivvnmvkerlrqpdaqengwlldgyprsysqamaletleirpdtfilldvpdell
    vervvgrrldpvtgkiyhlkysppeneeiasrltqrfddteekvklrletyyqnieslls
    tyeniivkvqgdatvdavfakidellgsilekknemvsst