PDB entry 1zaj

View 1zaj on RCSB PDB site
Description: Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with mannitol-1,6-bisphosphate, a competitive inhibitor
Class: lyase
Keywords: aldolase, competitive inhibitor, non covalent complex, mannitol-1, 6-bisphosphate, hexitol-1, LYASE
Deposited on 2005-04-06, released 2005-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zaja_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zajb_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zajc_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1zajd_
  • Heterogens: M2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zajA (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zajB (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zajC (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zajD (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay