PDB entry 1zae

View 1zae on RCSB PDB site
Description: Solution structure of the functional domain of phi29 replication organizer p16.7c
Class: DNA binding protein
Keywords: phi-29 replication, nonspecific DNA binding protein, helical dimer
Deposited on 2005-04-06, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: early protein gp16.7
  Species: Bacteriophage phi-29
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16517 (2-69)
    • cloning artifact (0-1)
  Domains in SCOP 1.73: d1zaea1
• Chain 'B':
  Compound: early protein gp16.7
  Species: Bacteriophage phi-29
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16517 (2-69)
    • cloning artifact (0-1)
  Domains in SCOP 1.73: d1zaeb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zaeA (A:)
  hmdktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklen
  qkklyrgslk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zaeB (B:)
  hmdktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklen
  qkklyrgslk