PDB entry 1zad

View 1zad on RCSB PDB site
Description: Structure of cytotoxin I (CTI) from Naja Oxiana in complex with DPC micelle
Class: toxin
Keywords: antiparallel beta-sheet, beta-turn type I, beta-turn type II, TOXIN
Deposited on 2005-04-06, released 2006-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxin 1
    Species: Naja oxiana [TaxId:8657]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zada_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zadA (A:)
    lkcnklvpiayktcpegknlcykmfmmsdltipvkrgcidvcpknsllvkyvccntdrcn