PDB entry 1zac

View 1zac on RCSB PDB site
Description: n-domain of troponin c from chicken skeletal muscle, nmr, minimized average structure
Class: calcium-binding
Keywords: calcium-binding, ef-hand, muscle protein, low-temperature
Deposited on 1998-04-07, released 1998-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin-c
    Species: Gallus gallus [TaxId:9031]
    Gene: NTNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1zaca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zacA (A:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkeda