PDB entry 1zac

View 1zac on RCSB PDB site
Description: n-domain of troponin c from chicken skeletal muscle, nmr, minimized average structure
Deposited on 1998-04-07, released 1998-11-11
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-21, with a file datestamp of 1999-06-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1zac__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1zac_ (-)
  asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
  iieevdedgsgtidfeeflvmmvrqmkeda